|
|
||||||||
Department of Pharmacology, University College London, London, United Kingdom
Abstract I. Introduction A. Molecular Subtypes of Calcium Channel II. Role of CaV{beta} Subunits in Calcium Channel Function A. Binding of CaV{beta} to the {alpha}1 I-II Linker B. Binding of CaV{beta} Subunits to the N and C Termini of CaV{alpha}1 Subunits III. Modulation of Calcium Channels IV. Inhibitory Coupling between G Proteins and Voltage-Gated Calcium Channels in Native Tissue A. The G Protein Subunits Involved in the Direct Inhibitory Modulation of Native and Heterologously Expressed Calcium Channels B. Voltage Dependence of G Protein Modulation of Calcium Channels C. The Role of the CaV{alpha}1 I-II Linker in G Protein Modulation of CaV2 Calcium Channels D. The Essential Role of the CaV{alpha}1 N Terminus in G Protein Modulation E. Basis for the Selectivity of Calcium Current Inhibition by Transmembrane G Protein-Coupled Receptors F. Is There a Role for the C Terminus in Calcium Current Inhibition by G Protein-Coupled Receptors? V. Essential Role of Cav{beta} Subunits in G Protein Modulation of Calcium Channels A. Initial Evidence for the Role of CaV{beta} Subunits in G Protein Modulation in Native Neurons B. The Involvement of CaV{beta} Subunits in G Protein Inhibition of Heterologously Expressed Calcium Channels C. Does G{beta}{gamma} Displace CaV{beta} Subunits? D. Potential Overlap of Determinants for CaV{beta} Subunit and G{beta}{gamma} Subunit Function VI. Molecular Mechanism of G Protein-Mediated Inhibition VII. Recovery from G Protein-Mediated Inhibition VIII. Conclusion
| Abstract |
|---|
|
|
|---|

dimers, and the cytoplasmic linker between domains I and II of the CaV2
1 subunits binds G
dimers, whereas the intracellular N terminus of CaV2
1 subunits provides essential determinants for G protein modulation. Evidence suggests a key role for the
subunits of calcium channels in the process of G protein modulation, and the role of a class of proteins termed "regulators of G protein signaling" will also be described. | I. Introduction |
|---|
|
|
|---|
In neurons it was clear that a component of the HVA calcium current was not L-type, for example, in Purkinje cells in the cerebellum (Hillman et al., 1991
) and at presynaptic terminals (see Stanley and Atrakchi, 1990
for example). These additional current components were subclassified with the aid of several invaluable toxins. Two additional subtypes of calcium channel were thus identified: N-type channels, sensitive to
-conotoxin GVIA (Nowycky et al., 1985b
; McCleskey et al., 1987
) and P-type channels, sensitive to
-agatoxin IVA (Mintz et al., 1992
). Another
-agatoxin IVA-sensitive current component was subsequently identified in cerebellar granule cells and termed Q-type current (Randall and Tsien, 1995
), but these two components are now combined as P/Q. There is also a residual or R-type calcium current component that is resistant to DHPs and the N and P/Q channel toxins (Randall and Tsien, 1995
).
A. Molecular Subtypes of Calcium Channel
The molecular basis for the physiological subtypes of VGCCs was clarified after the identification of the subunits of voltage-gated calcium channels. This era started with the purification of skeletal muscle calcium channel complex also called the DHP receptor, which consisted of
1,
2,
,
, and
subunits (Flockerzi et al., 1986
; Hosey et al., 1987
; Takahashi et al., 1987
; Chang and Hosey, 1988
; Hymel et al., 1988
).
After identification of individual subunits, the sequencing of peptides derived from these subunits formed the basis for the subsequent identification and cloning of the cDNA for the DHP receptor, initially from skeletal muscle (Tanabe et al., 1987
) and subsequently from heart by homology with the skeletal muscle sequence (Mikami et al., 1989
) (Fig. 1A). The
1 subunits have 24 putative transmembrane segments, arranged into four homologous domains, with intracellular linkers and N and C termini (Fig. 1A). Ten different
1 subunits have been cloned that have specialized functions and distributions (for review, see Ertel et al., 2000
) (Fig. 1B). Those that are of most concern to this review are the CaV2 subfamily of HVA calcium channels that shows classical modulation by G proteins, comprising CaV2.1 or
1A, the molecular counterpart of P/Q-type calcium channels (Mori et al., 1991
), CaV2.2 or
1B (Dubel et al., 1992
), the molecular counterpart of N-type calcium channels, and CaV2.3 or
1E (Soong et al., 1993
), thought to contribute to the molecular counterpart of the R-type calcium current component (Piedras-Rentería and Tsien, 1998
) (Fig. 1B, boxed).
|
In the case of the N- and P/Q-type as well as the L-type HVA calcium channels, the CaV
1 subunit has been shown to copurify with an intracellular
subunit (CaV
) (Liu et al., 1996
; Scott et al., 1996
). Four
subunits have been cloned (
14), with
1a being the skeletal muscle isoform of
1 (Ruth et al., 1989
),
2 being cloned initially from cardiac muscle (Perez-Reyes et al., 1992
),
3 present in cardiac and smooth muscle and neuronal tissue (Castellano et al., 1993b
), and
4 cloned from brain (Castellano et al., 1993a
). A number of splice variants have been identified, with one particular splice variant of
2,
2a, being N-terminally palmitoylated in certain species, giving it distinctive properties (Chien et al., 1996
).
HVA calcium channels also copurify with an extracellular CaV
2 subunit, which is attached by S-S bonds to a transmembrane
subunit (Tanabe et al., 1987
; Chang and Hosey, 1988
; Witcher et al., 1993
; Liu et al., 1996
). Four
2
subunits have been cloned (Ellis et al., 1988
; Klugbauer et al., 1999
; Barclay et al., 2001
; Qin et al., 2002
).
Skeletal muscle calcium channels also copurify with a
1 subunit (Takahashi et al., 1987
). Whether any of the recently cloned novel
-like subunits (
28) (Fig. 1B) are tightly associated with other types of VGCCs remains controversial (Letts et al., 1998
; Black and Lennon, 1999
; Klugbauer et al., 2000
; Kang et al., 2001
; Moss et al., 2002
; Tomita et al., 2003
).
II. Role of CaV Subunits in Calcium Channel Function
|
|---|
|
|
|---|
subunits have marked effects on the properties of HVA
1 subunits (CaV1 and CaV2 families), including trafficking of calcium channel complexes to the plasma membrane and modification of kinetic and voltage-dependent properties (Singer et al., 1991
subunits from native neurons results in a reduction of the amplitude of endogenous calcium currents and slowed kinetics of activation (Berrow et al., 1995
Most research indicates that all CaV
subunits (except truncated splice variants described recently (Hibino et al., 2003
; Hullin et al., 2003
) increase the functional expression of HVA
1 subunits (for a recent review, see Dolphin, 2003
). In theory, this could be attributable to effects on a number of channel properties, an increase in the open probability of the channel, an increase in single-channel conductance, an increase in the number of functional channels inserted into the plasma membrane, or a combination of several of these processes. Initial studies did not agree whether there was an increase in number of channels at the plasma membrane, measured as charge moved in isolated gating currents, with either no increase (Neely et al., 1993
) or an increase being reported (Josephson and Varadi, 1996
). Much early work on the roles of CaV
subunits in calcium channel expression was performed in Xenopus oocytes, but these cells are now known to contain an endogenous Xenopus
subunit that complicates the interpretation of these results (Tareilus et al., 1997
; Canti et al., 2001
). This endogenous CaV
subunit was found to be both necessary and able to traffic at least some heterologously expressed CaV channels to the plasma membrane, since if endogenous
subunit expression was reduced or eliminated by injection of
3 antisense oligonucleotides, CaV expression was largely lost (Tareilus et al., 1997
; Canti et al., 2001
).
In COS-7 cells, small currents were observed when CaV2.1, CaV2.2, and CaV2.3 were expressed alone, but exogenous
subunits all increased CaV2.1, CaV2.2, and CaV2.3 maximum conductance about 10-fold (Berrow et al., 1997
; Stephens et al., 1997
; Meir and Dolphin, 1998
; Stephens et al., 2000
). COS-7 cells do contain mRNA for endogenous
subunits (Meir et al., 2000
), but the protein for corresponding
subunits was not detectable by immunocytochemistry (Meir et al., 2000
), although a low level might be found if higher sensitivity detection methods were used. Thus, at the moment there are no expression systems that definitively contain no CaV
subunits that can be used conclusively to answer the question as to whether HVA calcium channels can be trafficked to the plasma membrane without a
subunit.
The increase in current density brought about by CaV
subunits can be attributed to a number of effects on biophysical properties as well as the important influence on trafficking. All CaV
subunits hyperpolarize the voltage dependence of activation of all HVA VGCCs (Fig. 2), whereas all, except the
2a splice variant that is N-terminally palmitoylated, hyperpolarize the voltage dependence of steady-state inactivation (Birnbaumer et al., 1998
). Where it has been studied, the
subunits all produce an increase in mean open time, which is at least in part due to a hyperpolarizing shift in the voltage dependence of the mean open time (Wakamori et al., 1999
; Meir et al., 2000
). Although CaV
1 subunits contain inherent determinants of voltage-dependent inactivation (Zhang et al., 1994
; Herlitze et al., 1997
; Cens et al., 1999
; Spaetgens and Zamponi, 1999
), association with different CaV
subunit isoforms dictates their overall kinetics of inactivation (Olcese et al., 1994
; Meir and Dolphin, 2002
). At the whole-cell level, the inactivation rate was affected in the following order (highest first)
3 >
1b >
4 >
2 subunits. Retardation of inactivation has been shown to be particularly dramatic for the palmitoylated CaV
2a subunit expressed with CaV1.2 (Chien and Hosey, 1998
), CaV2.2 (Bogdanov et al., 2000
; Stephens et al., 2000
), or CaV2.3 (Qin et al., 1998
).
|
A. Binding of CaV
to the
1 I-II Linker
CaV
subunits have been found to bind with very high affinity to the cytoplasmic intracellular linker between domains I and II of all HVA calcium channels, via an 18-amino acid motif called the
interaction domain (AID) on the I-II linker (Pragnell et al., 1994
). The AID sequence of rabbit CaV2.2 is QQIERELNGYLEWIFKAE, and the consensus sequence present in both CaV1.x and CaV2.x subfamilies is QQxExxLxGYxxWIxxxE.
A 41-amino acid sequence (BID) on the CaV
subunit was identified as the minimal motif required to influence
1 subunit expression and to bind to the
1 subunit (De Waard et al., 1994
, 1996
). The consensus sequence of BID is KEPYDVVPSMRPLVGPSLKGYEVTDMMKQALFDF; the underlined serines are consensus protein kinase C (PKC) phosphorylation sites. The residues in bold have been identified as particularly important for binding to CaV
1 subunits (Walker and De Waard, 1998
). This small BID sequence alone can produce an increase in calcium current density, albeit not to the same extent as the full-length protein (De Waard et al., 1994
). The affinity between CaV
subunits and a I-II linker fusion protein has been measured to be between 5 and 60 nM (De Waard et al., 1994
), but has been proposed to be state-dependent (De Waard et al., 1995
; Canti et al., 2001
). In one study (De Waard et al., 1995
), no dissociation was seen for
1b from the CaV2.1 I-II linker fusion protein after 10 h, but this may reflect a technical difficulty of overlay assays, because the bound protein may become directly anchored to the membrane. In our own binding studies using surface plasmon resonance, the affinity of
3 for the GST fusion protein of the I-II linker of CaV2.2 was about 20 nM, and the koff was 5.2 x 10-3 s-1 (Canti et al., 2001
). We found similar data (Fig. 3A) for
1b binding to the I-II linker of both CaV2.2 and CaV1.3 (Bell et al., 2001
).
|
We have studied the in vivo concentration dependence of the effects of CaV
subunits. Our evidence supports the hypothesis that there are two distinct binding processes for
subunits on CaV2.2 (Canti et al., 2001
). One is a high-affinity process related to the effect of CaV
on the maximum conductance of CaV2.2, presumably involving its trafficking to the plasma membrane, whose affinity corresponds closely to the in vitro affinity for the I-II linker (
17 nM), which is coincidentally the concentration of endogenous
3 estimated to exist in Xenopus oocytes (Canti et al., 2001
). The second process is of lower affinity (KD
120 nM), associated with the voltage-dependent effects of the
subunit, for example steady-state inactivation. One explanation for the discrepancy in these two calculated affinities is that a single binding site undergoes a marked reduction in affinity for CaV
subunits once the CaV
1 subunits have been trafficked from the endoplasmic reticulum and are inserted in the polarized plasma membrane. Alternatively, one might postulate the coexistence of two separate CaV
subunit binding sites on each CaV2.2 molecule, but the binding of two CaV
subunits has not been demonstrated directly (Canti et al., 2001
). Whichever hypothesis is correct, it is highly likely that the CaV
subunit interacts with other domains on the CaV
1 subunit as well as the I-II linker.
B. Binding of CaV
Subunits to the N and C Termini of CaV
1 Subunits
Two other
subunit interaction sites have been identified on various
1 subunits on the C terminus (Qin et al., 1997
; Walker et al., 1998
) and the N terminus (Walker et al., 1999
; Stephens et al., 2000
). These appear to be of lower affinity and may be selective for certain CaV
subunits. Whether they represent part of a single complex
subunit binding pocket made up of the I-II linker and the N and C termini remains to be established. However, the binding site found for
2a on the C terminus of CaV2.3 appeared to involve binding to the BID domain of
2a, the same as that which binds to the CaV
1 I-II linker, making it an alternative, rather than an additional site, for an individual CaV
subunit (Qin et al., 1997
). Walker et al. (1999
) showed that the N terminus of CaV2.1 interacted with CaV
4 and
2a but not
1b or
3. The region of
4 involved was within its C terminus (amino acids 446482). The C terminus of CaV
4 also bound to the C terminus of CaV2.1. The N and C termini of CaV2.1 were found to occupy overlapping binding sites that were mutually exclusive, but either could bind in combination with binding to the I-II linker (Walker et al., 1999
). This group also showed that CaV
4 produced a smaller hyperpolarizing shift of CaV2.1 currents than did CaV
3, and that this differential was due to the CaV2.1 N terminus. Stephens et al. (2000
) showed that CaV2.2 N-terminal residues in the same region as the essential site for G protein modulation (see Section IV.D.) were involved in retardation of inactivation kinetics by
2a. Palmitoylated
2a has been suggested to retard inactivation by tethering the I-II linker so that it cannot mediate inactivation (Restituito et al., 2000
; Stotz et al., 2000
), but our data show an additional role for the N terminus of CaV2.2.
| III. Modulation of Calcium Channels |
|---|
|
|
|---|
For the neuronal channels, particularly N- and P/Q-types, a major mechanism of inhibitory modulation occurs via the activation of heterotrimeric G proteins by seven transmembrane G protein-coupled receptors (GPCRs). GPCR activation was first found to reduce action potential duration in dorsal root ganglion neurons in the 1970s (Dunlap and Fischbach, 1978
). Subsequently, this effect was found to result from inhibition of voltage-gated calcium channels (Dunlap and Fischbach, 1981
). Such modulation has since been observed in many types of neuron, including superior cervical ganglion neurons (Ikeda and Schofield, 1989
) and submucosal neurons (Surprenant et al., 1990
).
The GPCRs typically involved in this type of modulation include
2-adrenoceptors, µ and
opioid receptors, GABA-B receptors (Fig. 4, A and B), and adenosine A1 receptors (Dunlap and Fischbach, 1978
; Dolphin et al., 1986
; Scott and Dolphin, 1986
). The key features that typify this inhibition are a slowing of the current activation kinetics, which is thought to be due to a time- and depolarization-dependent recovery from voltage-dependent inhibition (Bean, 1989
). The voltage dependence is manifested by a shift to more depolarized potentials of the current activation-voltage relationship and the loss of inhibition at large depolarizations, because of a shift from "reluctant" to "willing" channels (Bean, 1989
). Removal of inhibition can also be induced by a depolarizing prepulse applied immediately before the test pulse (Ikeda, 1991
). Additional mechanisms that are not voltage-dependent have also been described in various cell types manifested by a scaled reduction in the current and an inability of a depolarizing prepulse to reverse this component of the inhibition (for example, see Diversé-Pierluissi and Dunlap, 1993
).
|
N- and P/Q-type calcium channels support synaptic transmission and are concentrated at nerve terminals. P/Q-type channels are most important for transmitter release at central terminals (Takahashi and Momiyama, 1993
), although N-type channels are also present and particularly contribute earlier in development. In contrast, N-type channels are more prevalent in peripheral nerve terminals and are largely responsible for synaptic transmission in autonomic and sensory terminals (Mochida et al., 1996
; Koh and Hille, 1997
). Modulation of these channels by activation of GPCRs has been shown to occur both in cell bodies (Holz et al., 1986
; Scott and Dolphin, 1986
; Dolphin and Scott, 1987
; Ikeda, 1991
) and at presynaptic terminals (Takahashi et al., 1998
). This mechanism may be responsible for at least some of the presynaptic inhibition of synaptic transmission mediated by a wide variety of GPCRs in many areas of the nervous system (Dolphin and Prestwich, 1985
; Man-Son-Hing et al., 1989
; Toth et al., 1993
). Activation of GPCRs such as the GABA-B receptor will reduce calcium entry into presynaptic terminals via VGCCs by the same mechanism that is observed in cell bodies (Fig. 4A), and the effect should also be frequency- and potential-dependent. Inhibition will be reduced during a high-frequency train as a result of the voltage dependence of the inhibitory modulation. Relief of inhibition of calcium currents, evoked by action potential-like voltage waveforms, has been reported during high-frequency trains (Williams et al., 1997
; Brody and Yue, 2000
) and may contribute to the modulation of presynaptic inhibition according to input frequency.
| IV. Inhibitory Coupling between G Proteins and Voltage-Gated Calcium Channels in Native Tissue |
|---|
|
|
|---|
A. The G Protein Subunits Involved in the Direct Inhibitory Modulation of Native and Heterologously Expressed Calcium Channels
The modulation of neuronal VGCCs in most native neurons is usually mediated by receptors coupled to pertussis toxin-sensitive G proteins (Gi and Go subtypes) (Holz et al., 1986
; Scott and Dolphin, 1986
). The response to an agonist can be mimicked by nonhydrolyzable analogs of GTP such as guanosine 5'-O-(3-thiotriphosphate) (GTP
S) (Fig. 4C) (Dolphin and Scott, 1987
) and by photoactivation of a caged GTP analog (Dolphin et al., 1988
). The effect of GTP analogs is, as expected, more extensive than that of receptor agonists and is irreversible because G proteins are permanently activated. To provide evidence that the effect of agonists is mediated by G proteins, initial experiments showed that the effect of agonists is enhanced and made irreversible by a low concentration of GTP
S (Scott and Dolphin, 1986
) and prevented by a GDP analog such as guanosine 5'-O-(2-thiodiphosphate) (Holz et al., 1986
; Dolphin and Scott, 1987
).
To identify which G proteins are involved in receptormediated inhibition of calcium channels in native systems (such as dorsal root ganglion neurons and sympathetic neurons), a number of studies were performed with blocking antibodies and antisense oligonucleotides complementary to G protein
subunits, which showed that G
o was primarily responsible for the response (McFadzean et al., 1989
; Baertschi et al., 1992
; Campbell et al., 1993
; Menon-Johansson et al., 1993
). However, others found that both G
i and G
o were involved (Ewald et al., 1989
), and in several studies, Gs- or Gq-coupled receptors produced similar modulation (Shapiro and Hille, 1993
; Golard et al., 1994
; Zhu and Ikeda, 1994
). This led to the hypothesis that the species involved was the moiety common to all these G proteins, G
rather than any particular G
, and this was subsequently found to be the case (Herlitze et al., 1996
; Ikeda, 1996
), although previously other groups had directly investigated the involvement of G
in calcium channel modulation and not found any effect of its infusion (Hescheler et al., 1987
). However, there was a clear precedent for an effector role for G
in the G protein-activated potassium channels (GIRKs). Although for many years a controversy reigned concerning which G protein subunit was responsible for modulation of the native GIRKs (e.g., Yatani et al., 1987
), they were eventually shown conclusively to be activated by G
s (Logothetis et al., 1987
; Kurachi et al., 1989
; Clapham and Neer, 1993
). Furthermore, most G
combinations tested except transducin (G
1
1) are similarly effective (Wickman et al., 1994
; Yamada et al., 1997
). From the work of two groups (Herlitze et al., 1996
; Ikeda, 1996
), it became clear that transfection of either primary neurons or cell lines with G
subunits mimicked agonist effects and led to tonic inhibition of the calcium current, which could be transiently reversed by a depolarizing prepulse, applied just before the test pulse, a hallmark of voltage-dependent inhibition of these channels.
Taking examples for illustration from our own work (Meir et al., 2000
), the effect of coexpression of G
with N-type calcium channels can be seen both at the whole-cell and at the single-channel level (Figs. 5A, and 6A). When CaV2.2 was coexpressed in COS-7 cells with
2a and G
1
2, the whole-cell currents were very small and slowly activating but were markedly enhanced by a depolarizing prepulse (Fig. 5A, left panel). The time constant of activation of the peak current at 0 mV in the presence of G
was about 27 ms, compared with less than 5 ms in the presence of the G
binding domain of
-adrenergic receptor kinase 1 (
-ARK1) to bind any free endogenous G
. At the single-channel level, the slow activation of CaV2.2/
2a channels was seen as a marked prolongation of the latency to first opening (Fig. 6A, compare traces in right panel with G
with those in the left panel with
-ARK1). Indeed, there were many instances where no openings were observed to a test pulse. The latency to first opening was significantly reduced by a large depolarization (Fig. 6A, right panel). G
overexpression also occluded modulation by agonist (Ikeda, 1996
). The G
-mediated inhibition presents a picture that is very similar to that of agonist-mediated inhibition in terms of slowed activation and reversal by a large depolarizing prepulse. This is illustrated in an example from work by my own group, showing the effect of quinpirole-mediated activation of a coexpressed D2-dopamine receptor on the same channel combination (Fig. 7A) (Meir et al., 2000
).
|
|
|
The involvement of G
dimers as mediators of the G protein-signaling pathway does not call into question the finding by many groups that G
o is involved in receptor-mediated inhibition in many native systems (Ewald et al., 1989
; McFadzean et al., 1989
; Campbell et al., 1993
; Menon-Johansson et al., 1993
; Degtiar et al., 1996
), because Go is present in very high concentrations, particularly in neurons. Thus, in the absence of the G
o subunit, GPCR-mediated signaling will be markedly attenuated since it depends on the G protein heterotrimer.
Nevertheless, a number of studies have further concluded that there is a specific role for G
subunits. In some cell types, a marked specificity of different G

combinations for signaling pathways between different receptors and calcium channels has been demonstrated (Kleuss et al., 1991
; Degtiar et al., 1996
). These findings might also be reconciled with the evidence that most G
subunits are able to transduce the signal to calcium channels (Ikeda, 1996
; Garcia et al., 1998
; Ruiz-Velasco and Ikeda, 2000
) by interpreting that a specific G protein heterotrimer combination may selectively couple to a particular receptor in intact cells, and the selectivity is therefore largely at the receptor-G protein interaction step or due to segregation into different compartments, rather than due to G
specificity. In one study, however, it was concluded that there was an effector role for G
i3 subunits (Furukawa et al., 1998b
). In this study, either G
or G
moieties were coexpressed in Xenopus oocytes with CaV2.2 or CaV2.1 channels and the µ-opioid receptor. Receptor-mediated inhibition was found to be enhanced by coexpression of G
, which was therefore said to mediate this inhibition; but a more likely explanation of this finding is that expression of exogenous G
increases the amount of G

available for coupling to the receptor (Jeong and Ikeda, 1999
; Canti and Dolphin, 2003
) rather than that a specific G
mediates the response. In another study in chick sensory neurons, it was originally suggested that following activation of
2-adrenoceptors, G
dimers were responsible for the voltage-independent inhibition via activation of PKC and activated G
for voltage-dependent inhibition via an unknown second messenger (Diversé-Pierluissi and Dunlap, 1993
; Diversé-Pierluissi et al., 1995
). It is unknown whether different pathways might be activated in avian neurons. Interpretation of the role of phosphorylation in mediating a pathway must always bear the proviso that phosphorylation might also occlude receptor-mediated effects by receptor down-regulation.
I have further examined whether G
subunits play any role in mediating calcium channel inhibition, by the use of receptor-G
fusion proteins. I found that there was no difference between
2 adrenoreceptor-G
o and -G
i tandems and the wild-type
2 adrenoreceptor in their ability to support G protein-mediated inhibition of N-type calcium channels in an expression system, and also no difference in the voltage dependence of the inhibition (Fig. 8), despite the fact that no G
amplification would occur in the case of the tandems (Bertaso et al., 2003
). This is in contrast to the selective inhibition by Go rather than Gi in sympathetic neurons (Delmas et al., 1999
), which may depend on localization within discrete membrane compartments in native cells (Delmas et al., 2000
). Thus, coexpression studies in heterologous systems provide information on what is possible, but studies in native cells, using different means of interfering with the signal transduction pathway or its intermediates, provide information on what actually happens in any given cell. Both types of study are essential to place the correct interpretation on data from native cells.
|
One G
subunit, G
5, when overexpressed in sympathetic neurons was less effective than other G
subunit combinations at producing G protein modulation of VGCCs (Ruiz-Velasco and Ikeda, 2000
). This may be because G
5 preferentially interacts with certain regulators of G protein signaling (RGS) proteins with G protein
-like domains, rather than with G
subunits themselves (Snow et al., 1998
), and also couples selectively to the Gq family of G
subunits (Fletcher et al., 1998
).
B. Voltage Dependence of G Protein Modulation of Calcium Channels
It is commonly accepted that the relief of G protein-mediated inhibition by depolarization is a result of rapid dissociation of G
dimers from the channel at depolarized potentials. This process is thought to be strongly voltage- and time-dependent (see Figs. 5A and 6A for examples) and, as suggested above, is also believed to cause the slow relaxation observed in response to a test pulse (Jones and Elmslie, 1997
). Furthermore, re-establishment of inhibition after a prepulse, during a period at the holding potential, is likely to result from rebinding of G
dimers. Whether these processes actually result in physical dissociation and reassociation between the G protein subunits and channel remains formally to be established. However, the finding that the rate of reblock is dependent on the concentration of activated G protein is consistent with this view (Elmslie and Jones, 1994
; Stephens et al., 1998a
; Zamponi and Snutch, 1998
). The interpretation of these results is that the process involves binding from the pool of free G
dimers.
C. The Role of the CaV
1 I-II Linker in G Protein Modulation of CaV2 Calcium Channels
The combination of two findings, 1) that G
dimers are the mediators of inhibitory modulation, and 2) that there is a functional interaction between CaV
subunits and G
(Campbell et al., 1995), led a number of groups to examine the intracellular I-II linker in detail. G
dimers have been found previously to bind to sites on type 2 adenylyl cyclase and phospholipase C
2 (Chen et al., 1995
), which have a characteristic central motif consisting of QXXER. Whereas this motif is not necessarily indicative of a functional G
binding site, it is also found to occur in the I-II loop of CaV2.1, CaV2.2, and CaV2.3, intriguingly within the binding site described for the VGCC
subunit (QQIERELNGYWI-KAE) (Pragnell et al., 1994
). Furthermore, it is modified in the cognate region in L-type channels (QQLEEDL-GYWITQ-E).
It is clear that G
binds to the I-II linker of G protein-modulated calcium channels. This has been shown by several groups using overlay assays (De Waard et al., 1997
; Zamponi et al., 1997
) and also by the use of a surface plasmon resonance-based system to measure reversible binding, where the on- and off-rates can be measured, showing an affinity of G
for the I-II linker of CaV2.2 of 62 nM (Fig. 3B) (Bell et al., 2001
). Furthermore, the I-II linker of the L-type channel CaV1.3 does not bind G
, although it will bind CaV
subunits (Bell et al., 2001
). The residues in the I-II linker critical for G
binding have been mapped (De Waard et al., 1997
). As predicted, the AID part of the linker is one important domain, and some residues of the QQIER sequence were shown to be essential for G
binding (De Waard et al., 1997
).
The role of the I-II linker G
binding site in the process of G protein modulation remains controversial. Initial electrophysiological studies that supported a major role for the I-II linker used peptides derived from the I-II linker region in the patch pipette and found that they blocked G protein modulation (Herlitze et al., 1997
; Zamponi et al., 1997
). However, peptides alone do not prove that the CaV
1 I-II loop is the site of modulation but rather indicate whether the peptides bind to G
and can therefore effectively compete for this mediator. Chimeric and mutant channels have also been made between those channels that showed the greatest G protein modulation, such as CaV2.2, and those that exhibited no or less modulation, in an attempt to define the regions involved in this process. Three groups found that the I-II linker was key to G
modulation (De Waard et al., 1997
; Herlitze et al., 1997
; Zamponi et al., 1997
). Zamponi et al. (1997
) made chimeras between CaV2.1 and CaV2.2 by putting the I-II linker of CaV2.2 into CaV2.1, which resulted in an increased modulation, with CaV
1b as the coexpressed
subunit. However, both the channels used in this study were G protein modulatable. De Waard et al. (1997
) found that a mutation that prevented G
binding (R
E in QQIER) also prevented inhibitory modulation of CaV2.1/
4 by GTP
S injection into oocytes, although in this study only a small amount of inhibition was observed with GTP
S even in the wild-type CaV2.1. However, Herlitze et al. (1997
) mutated the QQIER sequence in CaV2.1 to that in CaV1.2, which is QQLEE, and found a reduction of modulation of the channel coexpressed with
1b by GTP
S, but not an abolition. Interestingly, in this study, they observed that CaV2.1 with the sequence QQIEE showed increased, rather than decreased, modulation by GTP
S, in contrast to the results of De Waard et al. (1997
).
Two other groups found that the presence of an I-II linker from a G protein-modulatable channel was either not essential for G protein modulation or not the most critical region (Zhang et al., 1996
; Page et al., 1997
, 1998
; Canti et al., 1999
). The results of Zhang et al. (1996
) showed that neither the I-II linker from CaV2.1 nor that from CaV1.2 reduced modulation in a CaV2.2 backbone when coexpressed with
1. In agreement, the results of Page et al. (1997
) showed that insertion of the I-II linker of CaV2.2 into a CaV2.3 construct (RbEII) (Soong et al., 1993
), which had a truncated N terminus, did not restore the G protein modulation shown by CaV2.2/
1b. Furthermore, Canti et al. (1999
) showed that the I-II linker of CaV2.2 inserted into a CaV1.2 backbone and coexpressed with
2a did not allow any G protein modulation (Fig. 9). Both groups found that domain I of G protein-modulated channels was a key region in the process of G protein modulation (Zhang et al., 1996
; Stephens et al., 1998b
). The discrepancies do not appear to be due to the different G
dimers or CaV
subunits used, because the different groups have coexpressed channels with a variety of different CaV
subunits,