TABLE 14

Amino acid sequences resulting from 5′ splicing of OPRM1

The exon 11 sequences are immediately upstream of exon 2, as noted. The N-terminal fusion sequences exon 11-associated splice variants are found in the rat and human variants, as noted. In the human variant hMOR-1i, translation is initiated at the AUG at the beginning of exon 1c, which encodes 49 aa,and the proceeds through exon 1a, with an additional 44 aa generated by the exon 1a sequence immediately upstream of the AUG used to initiate translation in MOR-1. In the rat variant rMOR-1H2, the additional sequence comes from exon 11a, which is joined to exon 1. Translation in the full exon 11a/b leads to a truncated protein corresponding to only the first 7 aa shown for exon 11a alone. The * designates the termination of translation due to a stop codon, and the indicated peptide is the complete product.

SpeciesExonVariantAmino Acid Sequence
Exon 11 sequences
 MouseExon 11mMOR-1G/M/NMMEAFSKSAFQKLRQRDGNQEGKSYLR
 HumanExon 11a/bhMOR-1G1MMRAKSISTKAGKPSRFIWKKILL*
Exon 11ahMOR-1G2MMRAKSISTKAGKPSR
 RatExon 11arMOR-1G2MGSGPML
Exon 11a/brMOR-1G1MGSGPML*
N-terminal fusion sequences
 HumanExon 1c/ahMOR-1iMCLHRRVPSEETYSLDRFAQNPPLFPPPSLPASESRMAHAPLLQRCGAARTGFCKKQQELWQRRKEAAEALGTRKVSVLLATSHSGARPAVST
 RatExon 11arMOR-1H2MGSGPMLAGPCKNLTEPRAAVRGRGWGAWNPKSLSALSYSLPSPQQAFST